SAB1401276

Monoclonal Anti-PAFAH2 antibody produced in mouse

clone 1A8, purified immunoglobulin, buffered aqueous solution

• 동의어(들): FLJ26025, HSD-PLA2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1A8, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: capture ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: NM_000437
• UniProt 수납 번호: Q99487
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PAFAH2(5051)

설명

일반 설명

This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme. (provided by RefSeq)

면역원

PAFAH2 (NP_000428, 293 a.a. ~ 392 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable