SAB1401190

Anti-IAPP antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• 동의어(들): AMYLIN, DAP, IAP
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• NCBI 수납 번호: NM_000415
• UniProt 수납 번호: P10997
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... IAPP(3375)

설명

일반 설명

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer′s disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. (provided by RefSeq)

면역원

IAPP (NP_000406.1, 1 a.a. ~ 89 a.a) full-length human protein.

Sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

생화학적/생리학적 작용

IAPP (islet amyloid polypeptide) is secreted by the pancreatic β-cells along with insulin. IAPP is known to be involved in the regulation of gastric emptying, satiety and inhibiting glucagon secretion. IAPP is associated with type 2 diabetes mellitus where IAPP is part of amyloid deposits and is associated with mass and functional loss of β-cells. Oligomers and fibrils formed by IAPP is known to be toxic to the pancreatic islet β-cells.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable