SAB1400250

Anti-S100A7 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• 동의어(들): Anti-PSOR1, Anti-S100A7c
• UNSPSC 코드: 12352203

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1 μg/mL
• UniProt 수납 번호: P31151
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... S100A7(6278)

설명

일반 설명

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. (provided by RefSeq)

면역원

S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length human protein.

Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable