MSST0060

SILu^™Lite CST3, Cystatin C human

recombinant, expressed in E. coli, MS Protein Standard

• 동의어(들): CST3, Cystatin C
• UNSPSC 코드: 23201100
• NACRES: NA.32

속성

• 재조합: expressed in E. coli
• Quality Level: 200
• 분석: ≥95% (SDS-PAGE)
• 형태: lyophilized powder
• 적합성: suitable for mass spectrometry (internal calibrator)
• UniProt 수납 번호: P01034 (aa 27-146)
• 배송 상태: ambient
• 저장 온도: −20°C
• 유전자 정보: human ... CST3(1471)

설명

일반 설명

SILu^™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu^™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

생화학적/생리학적 작용

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

서열

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

물리적 형태

Supplied as a lyophilized powder containing tris buffered saline and methionine.

법적 정보

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable