MSST0007

SILu^™Prot CLU Clusterin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• 동의어(들): Apolipoprotein J, Clusterin, Testosterone-repressed prostate message 2 (TRPM-2)
• UNSPSC 코드: 23201100
• NACRES: NA.12

속성

• 생물학적 소스: human
• Quality Level: 200
• 재조합: expressed in HEK 293 cells
• 태그: His tagged; V5 tagged
• 분석: ≥98% (SDS-PAGE)
• 양식: lyophilized powder
• 효능: ≥98% Heavy amino acids incorporation efficiency by MS
• 분자량: 56811.45
• 기술: mass spectrometry (MS): suitable
• 적합성: suitable for mass spectrometry
• UniProt 수납 번호: P10909
• 저장 온도: −20°C
• 유전자 정보: human ... CLU(1191)

설명

일반 설명

SILu^™ Prot Clusterin is a recombinant, stable isotope-labeled human Clusterin which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of Clusterin in mass-spectrometry. SIL^™ Prot Clusterin is a heterodimer of 2 subunits (alpha and beta) consisting of 427 amino acids (including N-terminal polyhistidine and V5 tags), with a calculated molecular weight of 50 kDa.

생화학적/생리학적 작용

Clusterin is a secreted glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including anti-apoptotic cell survival, cell cycle regulation, cell adhesion, tissue remodeling and lipid transportation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.

서열

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREESDPSRGPFEGKPIPNPLLGLDSTRTGHHHHHHHHGGQ

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline.

법적 정보

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 13 - Non Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable