MSQC21

SILu^™MAb Bevacizumab Stable-Isotope Labeled Monoclonal Antibody

recombinant, expressed in CHO cells

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 재조합: expressed in CHO cells
• 분석: ≥90% (SDS-PAGE)
• 형태: solid
• 적합성: suitable for mass spectrometry
• 배송 상태: wet ice
• 저장 온도: −20°C

설명

일반 설명

SILu^™MAb Bevacizumab (MSQC21) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [₁₃C⁶, ₁₅N⁴]-Arginine and [₁₃C⁶, ₁₅N²]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Bevacizumab in human serum.

SILu^™MAb Bevacizumab is for R&D use only. Not for drug, household, or other uses.

서열

SILu^™MAb Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILu^™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

분석 메모

Quantitative

MRM settings provided (download .xls file)

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 3