콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA039557

Sigma-Aldrich

Anti-TAZ antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-BTHS, Anti-CMD3A, Anti-EFE, Anti-EFE2, Anti-G4.5, Anti-Tafazzin, Anti-XAP-2

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩837,477

₩837,477


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩837,477

About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

₩837,477


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:20- 1:50

면역원 서열

WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... TAZ(6901)

일반 설명

Tafazzin (TAZ) is encoded by the WW domain containing transcription regulator 1 (WWTR1) gene mapped to human chromosome Xq28. The encoded protein contains 400 amino acids. It is characterized by a conserved WW domain, implicated in binding PPXY motif, a coiled-coil region associated with protein-protein interaction and a C-terminal motif involved in binding the PDZ domain.

면역원

tafazzin recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-TAZ antibody produced in rabbit has been used in immunohistochemistry and immunoprecipitation.[1]
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

Tafazzin (TAZ) plays a vital role in the various cellular process including cell proliferation, differentiation, apoptosis, migration, invasion, epithelial-mesenchymal transition (EMT) and stemness in multiple human cancers. TAZ associates with other transcription factors such as RUNX2 (runt-related transcription factor 2), PPAR (peroxisome proliferator-activated receptor), PAX3 and 8 (paired box gene 3 and 8) and TTF1 (thyroid transcription factor 1) and plays an essential role in osteoblastic, myogenic and adipogenic differentiation.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST77964

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Yugang Wen et al.
Journal of personalized medicine, 10(4) (2020-10-18)
Radiation therapy has long been contemplated as an important mode in the treatment of rectal cancer. However, there are few ideal tools available for clinicians to make a radiotherapy decision at the time of diagnosis for rectal cancer. The purpose
Aerobic glycolysis tunes YAP/TAZ transcriptional activity.
Enzo E, et.al.
The Embo Journal, 34, 1349-1370 (2015)
Intra-individual plasticity of the TAZ gene leading to different heritable mutations in siblings with Barth syndrome.
Ferri L
European Journal of Human Genetics, 23, 1708-1712 (2015)
Tafazzin protein expression is associated with tumorigenesis and radiation response in rectal cancer: a study of Swedish clinical trial on preoperative radiotherapy.
Pathak S
PLoS ONE, 9 (2014)
Regulation of TAZ in cancer.
Zhou X and Lei QY
Protein & cell, 7, 548-561 (2016)

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.