₩837,477
구입 가능 여부는 고객센터에 문의하십시오.
추천 제품
![4-[2-[Benzyl(tert-butyl)amino]-1-hydroxyethyl]-2-(hydroxymethyl)phenol certified reference material, TraceCERT®, Manufactured by: Sigma-Aldrich Production GmbH, Switzerland](/deepweb/assets/sigmaaldrich/product/structures/185/185/ca94783e-a5cc-4732-989f-2869e429db56/640/ca94783e-a5cc-4732-989f-2869e429db56.png)
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunofluorescence: 0.25-2 μg/mL
면역원 서열
IKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TRPM2(7226)
일반 설명
Transient receptor potential cation channel subfamily M member 2 (TRPM2) belongs to the TRPM subfamily and is majorly expressed in the brain especially in substantia nigra, hippocampus, striatum, and cortex. It comprises a C-terminal nudix hydrolase 9 (NUDT9) homology domain, a six-helix transmembrane (TM) domain, a rib helix, and a pole helix. The TRPM2 gene is mapped to human chromosome 21q22.3. Variants of TRPM2 are observed in neutrophil granulocytes.
면역원
transient receptor potential cation channel, subfamily M, member 2
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
Transient receptor potential cation channel subfamily M member 2 (TRPM2) serves as a calcium-permeable cation channel. It is activated by nicotinamide adenine dinucleotide (NAD), ADP ribose, and by micro levels of hydrogen peroxide (H2O2). The C-terminal NUDT9 homology (NUDT9H) domain mediates adenosine monophosphate (AMP) and ribose-5-phosphate (R5P) synthesis from adenosine diphosphate (ADP)–ribose (ADPR). It is also permeable to sodium and potassium and activated by oxidant stress. TRPM2 via its calcium-signaling responses is involved in various immunological functions and neuroinflammation. It is also correlated to amyloid β (Aβ) generation as well as with the oxidative damage in the pathologies related to Alzheimer′s disease, and other diseases like multiple sclerosis and autism spectrum disorders.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST90730
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Takuji Uemura et al.
Biochemical and biophysical research communications, 328(4), 1232-1243 (2005-02-15)
Transient receptor potential melastatin 2 (TRPM2) is a calcium-permeable cation channel activated by ADP-ribose or reactive oxygen species. In human, a major transcript of 6.5 kb is expressed in various tissues, whereas a minor transcript of 5.5 kb is detected
Seung Yeon Ko et al.
Proceedings of the National Academy of Sciences of the United States of America, 116(5), 1770-1775 (2019-01-16)
Major depressive disorder (MDD) is a devastating disease that arises in a background of environmental risk factors, such as chronic stress, that produce reactive oxygen species (ROS) in the brain. The chronic stress-induced ROS production involves Ca2+ signals; however, the
Longfei Wang et al.
Science (New York, N.Y.), 362(6421) (2018-11-24)
Transient receptor potential (TRP) melastatin 2 (TRPM2) is a cation channel associated with numerous diseases. It has a C-terminal NUDT9 homology (NUDT9H) domain responsible for binding adenosine diphosphate (ADP)-ribose (ADPR), and both ADPR and calcium (Ca2+) are required for TRPM2
Philippa Malko et al.
Frontiers in pharmacology, 10, 239-239 (2019-03-28)
Microglial cells in the central nervous system (CNS) are crucial in maintaining a healthy environment for neurons to function properly. However, aberrant microglial cell activation can lead to excessive generation of neurotoxic proinflammatory mediators and neuroinflammation, which represents a contributing
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
