콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA014837

Sigma-Aldrich

Anti-HACD3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-B-ind1, Anti-HSPC121, Anti-PTPLAD1

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩917,154

₩917,154


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩917,154

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.43

₩917,154


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

면역원 서열

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLE

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PTPLAD1(51495)

일반 설명

HACD3 (3-hydroxyacyl-CoA dehydratase 3) is a multi-pass membrane protein, which shares high homology with p23, a co-chaperone. This protein is composed of 362 amino acids. This gene is localized to human chromosome 15q22.3. It was originally identified as a gene activated by sodium butyrate. It has a molecular weight of 70.6kDa, and the mRNA is highly expressed in brain, kidney, and liver, and has low expression in skeletal muscle. The protein is ubiquitously expressed.

면역원

3-hydroxyacyl-CoA dehydratase 3

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

HACD3 (3-hydroxyacyl-CoA dehydratase 3) controls gene expression through Rac-1 signaling pathway. It is involved in the replication of hepatitis C virus (HCV), by interacting with HCV nonstructural protein 5A (NS5A), and recruiting heat shock protein 90 (Hsp90) and FK506-binding protein 8 (FKBP8) to the replication complex. This protein is involved in erythropoiesis, in bone marrow, and activation of NF-κB and c-Jun N-terminal kinase, via Rac-1 pathway. It might be involved in the synthesis of very long chain fatty acids, by interacting with ELOVL1, ELOVL5, or ELOVL6.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73204

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Michèle Sabbah et al.
Gene, 374, 128-133 (2006-03-07)
Histone deacetylase inhibitors (HDIs) induced expression of the B-ind1 protein that is a component of Rac-1-signaling pathways leading to the modulation of gene expression. In the present study, we have determined the structure of the human B-ind1 gene promoter region.
Mika Ikeda et al.
FEBS letters, 582(16), 2435-2440 (2008-06-17)
Very long-chain fatty acids are produced through a four-step cycle. However, the 3-hydroxyacyl-CoA dehydratase catalyzing the third step in mammals has remained unidentified. Mammals have four candidates, HACD1-4, based on sequence similarities to the recently identified yeast Phs1, although HACD3
Shuhei Taguwa et al.
Journal of virology, 83(20), 10427-10436 (2009-08-07)
Hepatitis C virus (HCV) nonstructural protein 5A (NS5A) is a component of the replication complex consisting of several host and viral proteins. We have previously reported that human butyrate-induced transcript 1 (hB-ind1) recruits heat shock protein 90 (Hsp90) and FK506-binding
Keyue Ding et al.
Mayo Clinic proceedings, 87(5), 461-474 (2012-05-09)
To identify common genetic variants influencing red blood cell (RBC) traits. We performed a genomewide association study from June 2008 through July 2011 of hemoglobin, hematocrit, RBC count, mean corpuscular volume, mean corpuscular hemoglobin, and mean corpuscular hemoglobin concentration in

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.