콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

HPA014600

Sigma-Aldrich

Anti-MARCH1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-E3 ubiquitin-protein ligase MARCH1, Anti-MARCH- I, Anti-Membrane-associated RING finger protein 1, Anti-Membrane-associated RING-CH protein I, Anti-RING finger protein 171

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩917,154

₩917,154


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩917,154

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

₩917,154


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:50- 1:200

면역원 서열

KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MARCH1(55016)

일반 설명

MARCH1 (membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase) is a member of MARCH family of E3 ubiquitin ligases. This family is RING-v type ligases and has 11 members. Most proteins of this family have RING domain in their cytosolic N-terminal, and two transmembrane regions. MARCH1 is generally expressed on secondary lymphoid tissues, such as B-cells and dendritic cells. It is localized to plasma membrane and endosomes.

면역원

E3 ubiquitin-protein ligase MARCH1 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

MARCH1 (membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase) is involved in the maturation of dendritic cells. Its under-expression leads to stable surface expression of major histocompatibility (MHC) II, on dendritic cells. Its expression also determines the fate of CD98, post its endocytosis; whether CD98 is degraded or recycled. It is also capable of dimerization and auto-ubiquitination, thus, controlling its own expression. In antigen presenting cells (APCs), its expression is induced by interleukin (IL)-10, which leads to the suppression of MHCII expression. IL-10 is a strong anti-inflammatory cytokine and thus, MARCH1 plays a role in the suppression of immune response. It regulates the cell surface expression of its substrates such as, tumor necrosis factor-related apoptosis inducing ligand (TRAIL) receptor 1. It ubiquitinates and degrades TRAIL-R1, and maintains its steady state expression.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72906

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Jacques Thibodeau et al.
European journal of immunology, 38(5), 1225-1230 (2008-04-05)
IL-10 is a potent anti-inflammatory cytokine interfering with antigen presentation by inducing the intracellular sequestration of MHC class II (MHC-II) molecules. Here we studied the contribution of membrane-associated RING-CH (MARCH) ubiquitin ligase family members to the IL-10-induced down-regulation of MHC-II
Marie-Claude Bourgeois-Daigneault et al.
Journal of immunology (Baltimore, Md. : 1950), 188(10), 4959-4970 (2012-04-18)
Some members of the membrane-associated RING-CH family of E3 ubiquitin ligases (MARCHs) are membrane-bound and target major players of the immune response. MARCH1 ubiquitinates and downregulates MHC class II expression in APCs. It is induced by IL-10 and despite a
Craig A Eyster et al.
Molecular biology of the cell, 22(17), 3218-3230 (2011-07-16)
Following endocytosis, internalized plasma membrane proteins can be recycled back to the cell surface or trafficked to late endosomes/lysosomes for degradation. Here we report on the trafficking of multiple proteins that enter cells by clathrin-independent endocytosis (CIE) and determine that
Bert van de Kooij et al.
The Journal of biological chemistry, 288(9), 6617-6628 (2013-01-10)
The eleven members of the membrane-associated RING-CH (MARCH) ubiquitin ligase family are relatively unexplored. Upon exogenous (over)expression, a number of these ligases can affect the trafficking of membrane molecules. However, only for MARCH-1 endogenous functions have been demonstrated. For the

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.