콘텐츠로 건너뛰기
Merck
모든 사진(12)

주요 문서

HPA011272

Sigma-Aldrich

Anti-ANXA1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Annexin A1, Anti-Annexin I, Anti-Annexin-1, Anti-Calpactin II, Anti-Chromobindin-9, Anti-Lipocortin I, Anti-Phospholipase A2 inhibitory protein, Anti-p35

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩812,812

₩812,812


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩812,812

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

₩812,812


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human, rat, mouse

향상된 검증

independent
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

면역원 서열

MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ANXA1(301)

일반 설명

Annexin A1 (ANXA1) belongs to the annexin gene family and is a part of the A subfamily. It is a glucocorticoid-regulated, calcium and phospholipid-binding protein. This protein has a molecular weight of 37kDa.

면역원

Annexin A1 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

Annexin A1 (ANXA1) is involved in multiple cellular functions such as, cell proliferation and differentiation and signal transduction. Its expression is deregulated in various cancers such as, glial tumors, nasopharyngeal carcinoma, head and neck, larynx, esophageal, breast, hepatocellular, gastric, prostate and pancreatic cancer. It is up-regulated in rectal cancer and predicts poor prognostic response to concurrent chemoradiotherapy. ANXA1 is involved in anti-inflammatory processes, and regulates apoptosis and phagocytosis of apoptotic bodies. Its expression levels are altered in cystic fibrosis, and might be involved in the pathogenesis of glomerular disorders. It has potential as a marker for the diagnosis and prognosis of glomerular disorders. ANXA1 has a high level of expression in normal gastrointestinal epithelium, and might be involved in the maintenance of cellular boundaries. It also regulates gastric cancer cell proliferation and viability through COX2 (cyclooxygenase 2) pathway.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71576

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Omar Elakad et al.
Disease markers, 2021, 5520832-5520832 (2021-05-08)
Lung cancer remains the primary cause of cancer-related death worldwide, and its molecular mechanisms of tumor progression need further characterization to improve the clinical management of affected patients. The role of Annexin A1 (ANXA1) in tumorigenesis and cancer progression in
Sudarshan S Patil et al.
Frontiers in cell and developmental biology, 11, 1161588-1161588 (2023-07-03)
Introduction: The regulation of intracellular functions in mammalian cells involves close coordination of cellular processes. During recent years it has become evident that the sorting, trafficking and distribution of transport vesicles and mRNA granules/complexes are closely coordinated to ensure effective
Differential expression of ANXA1 in benign human gastrointestinal tissues and cancers.
Gao Y, Chen Y, Xu D, et al.
BMC Cancer, 14, 520-520 (2014)
Aifeng Liu et al.
Molecular medicine reports, 10(6), 3059-3067 (2014-10-18)
Nasopharyngeal carcinoma (NPC) has a highly increased incidence rate (20/100,000) in Southern regions of China, while being rare in the rest of the world. NPC is a malignant type of cancer due to its high occurrence rate of metastasis; however
Zhi-Qiang Zhang et al.
World journal of gastroenterology, 19(43), 7795-7803 (2013-11-28)
To study the differential expression of Annexin A1 (ANXA1) protein in human gastric adenocarcinoma. This study was also designed to analyze the relationship between ANXA1 expression and the clinicopathological parameters of gastric carcinoma. Purified gastric adenocarcinoma cells (GAC) and normal

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.