콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

HPA011138

Sigma-Aldrich

ANTI-APPL1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-APPL, Anti-Adapter protein containing PH domain, PTB domain and leucine zipper motif 1, Anti-DCC-interacting protein 13-alpha, Anti-Dip13-alpha

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩837,477

₩837,477


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩837,477

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

₩837,477


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:500- 1:1000

면역원 서열

VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... APPL1(26060)

일반 설명

APPL1 (adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1) is an endosomal adaptor protein which is made of 709 amino acids. It has a PTB (phosphotyrosine binding) domain at its C-terminal, Bin-Amphiphysin-Rvs (BAR) domain at the N-terminal, and an intervening pleckstrin homology (PH) domain. This gene is localized to the human chromosomal region 3p14.3-p21.1. It is abundantly expressed in heart, pancreas, ovary and skeletal muscle.

면역원

DCC-interacting protein 13-alpha recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

APPL1 (adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1) is an adaptor protein for AKT2 (v-akt murine thymoma viral oncogene homolog 2) and p110α, and anchors them to cytoplasm. This speeds the recruitment of AKT2 and p110α to cell membrane during cell division. Upon stimulation by epidermal growth factor (EGF) or oxidative stress, it moves from cell membrane to nucleus. It is therefore, involved in regulating transcription and chromatin modelling, by interacting with nucleosome remodeling and histone deacetylase multiprotein complex NuRD/MeCP1. APPL1 suppresses AKT by preventing Src-mediated phosphorylation of tyrosine residues. It thus, inhibits AKT mediated cell migration and adhesion. The BAR domain is responsible for sensing and inducing membrane curvature, and the PH domains interacts with phosphoinositols. It contributes to the development of synapses and dendritic spines in hippocampal neurons, and might play a role in memory impairment in Alzheimer′s disease (AD).

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72486

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Y Mitsuuchi et al.
Oncogene, 18(35), 4891-4898 (1999-09-22)
AKT2 is a serine/threonine kinase implicated in human ovarian and pancreatic cancers. AKT2 is activated by a variety of growth factors and insulin via phosphatidylinositol 3-kinase (PI3K). However, its normal cellular role is not well understood. To gain insight into
Marta Miaczynska et al.
Cell, 116(3), 445-456 (2004-03-16)
Signals generated in response to extracellular stimuli at the plasma membrane are transmitted through cytoplasmic transduction cascades to the nucleus. We report the identification of a pathway directly linking the small GTPase Rab5, a key regulator of endocytosis, to signal
Akari Ogawa et al.
Brain research, 1494, 118-124 (2012-12-19)
Adaptor protein containing a PH domain, PTB domain and leucine zipper motif (APPL1) is emerging as a critical regulator of various cellular processes in non-neuronal cells as well as in neurons where it localizes to dendritic spines and synapses. It
Joshua A Broussard et al.
Molecular biology of the cell, 23(8), 1486-1499 (2012-03-02)
Cell migration is a complex process that requires the integration of signaling events that occur in distinct locations within the cell. Adaptor proteins, which can localize to different subcellular compartments, where they bring together key signaling proteins, are emerging as

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.