HPA009164

Anti-SHOC2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Leucine-rich repeat protein SHOC-2 antibody produced in rabbit, Anti-Ras-binding protein Sur-8 antibody produced in rabbit
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA009164
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human, rat, mouse
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• 면역원 서열: LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
• UniProt 수납 번호: Q9UQ13
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SHOC2(8036)

설명

일반 설명

SHOC2 (SHOC2 leucine-rich repeat scaffold protein) is a conserved protein, which contains leucine-rich repeats. It was first recognized in Caenorhabditis elegans as a positive regulator of Ras (rat sarcoma) pathway. It is commonly known as a suppressor of Ras-8 (Sur8). It is a scaffold protein, which is conserved in all metazoans. Its N-terminal contains M-Ras and C-Raf-binding regions, and its C-terminal is responsible for its late endosome targeting.

면역원

Leucine-rich repeat protein SHOC-2 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-SHOC2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

생화학적/생리학적 작용

SHOC2 (SHOC2 leucine-rich repeat scaffold protein) results in increased activity of ERK (extracellular signal-regulated kinases), through interaction with Ras and Raf proteins. In mice, germline inactivation of this gene results in embryonic fatality. It plays an essential role in the development of embryonic heart, and might control atrioventricular canal (AVC) development in an ERK-independent manner. In the presence of EGF (epidermal growth factor) in PC12 cells, the up-regulation of SHOC2 protein results in elevated neurite extension. Thus, it plays a key role in the modulation of Ras-ERK signaling in cell differentiation events leading to neurite outgrowth. In cells stimulated by EGF, this protein is targeted to late endosomes, where it might promote EGFR-induced ERK activation, thus, controlling the spatiotemporal regulation of signaling through the Ras-Raf module.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71207

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)