콘텐츠로 건너뛰기
Merck
모든 사진(5)

주요 문서

HPA005633

Sigma-Aldrich

Anti-GATA2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Endothelial transcription factor GATA-2 antibody produced in rabbit, Anti-GATA-binding protein 2 antibody produced in rabbit

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩837,477

₩837,477


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩837,477

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

₩837,477


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

면역원 서열

LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... GATA2(2624)

일반 설명

GATA-binding protein 2 (GATA2) is a transcription factor involved in several neuronal specification pathways and expressed in the adipose tissue. The gene is mapped to human chromosome 3q21.3. It encodes a zinc finger protein belonging to the GATA family of proteins.

면역원

Endothelial transcription factor GATA-2 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-GATA2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-GATA2 antibody produced in rabbit has been used in immunoprecipitation.[1]

생화학적/생리학적 작용

GATA-binding protein 2 (GATA2) blocks the transition from preadipocytes to adipocytes through suppression of PPAR-γ2 expression. GATA2 is also known to direct hematopoiesis and vascular cell activation. Thus, preadipocytes inhibition of GATA2 could allow adipogenesis while reducing their inflammatory properties. It is an inhibitor of adipogenesis and an activator of vascular cells. GATA2 is phosphorylated and blocked by the PI3K/Akt signal transduction pathway, this phosphorylation results in preadipocyte conversion to adipocytes and attenuation of the inflammatory behavior of preadipocytes. The encoded protein is essential for the development of CNS and the differentaition of erythroid cells. Polymorphism in this gene has been associated with Parkinson′s disease.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST83056

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Harriet Holme et al.
British journal of haematology, 158(2), 242-248 (2012-04-27)
The myelodysplastic syndromes (MDS) are heterogeneous and can evolve into acute myeloid leukaemia (AML). Rare familial cases are reported in which five disease genes have been identified to date (RUNX1, CEBPA, TERC, TERT and GATA2). Here we report the genetic
Lewis Chaytor et al.
Molecular cancer research : MCR, 17(6), 1264-1278 (2019-03-06)
The androgen receptor (AR) is a key driver of prostate cancer development. Antiandrogens effectively inactivate the AR, but subsequent AR reactivation progresses the disease to castrate-resistant prostate cancer (CRPC). Constitutively active AR splice variants (AR-V) that function unchallenged by current
Abeer El Wakil et al.
Development (Cambridge, England), 133(11), 2155-2165 (2006-05-05)
Postmitotic neurons are produced from a pool of cycling progenitors in an orderly fashion that requires proper spatial and temporal coordination of proliferation, fate determination, differentiation and morphogenesis. This probably relies on complex interplay between mechanisms that control cell cycle
Mateusz Kurzawski et al.
Parkinsonism & related disorders, 16(4), 284-287 (2009-10-30)
It was shown that high levels of alpha-synuclein in substantia nigra are essential in pathogenesis of Parkinson disease (PD), and SNCA expression in neurons is controlled by GATA-2 transcription factor, which plays also crucial role in central nervous system development
Veronica Rodriguez-Bravo et al.
Cell, 174(5), 1200-1215 (2018-08-14)
Nuclear pore complexes (NPCs) regulate nuclear-cytoplasmic transport, transcription, and genome integrity in eukaryotic cells. However, their functional roles in cancer remain poorly understood. We interrogated the evolutionary transcriptomic landscape of NPC components, nucleoporins (Nups), from primary to advanced metastatic human

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.