HPA000325

Anti-ARMCX3 antibody produced in rabbit

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-ALEX3, Anti-GASP6
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA000325
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:50- 1:200
• 면역원 서열: MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAY
• UniProt 수납 번호: Q9UH62
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ARMCX3(51566)

설명

일반 설명

ARMCX3 belongs to armadillo repeat containing, X-linked (ARMCX) subfamily. It is known to be implicated in embryogenesis and tumorigenesis. ARMCX3 gene is mapped to human chromosome Xq21.33-q22.2. This gene encodes a protein ALEX3 (arm-containing protein lost in epithelial cancers linked to the X chromosome) which is known to be localized in cerebral cortex of the nervous system. It is a 379-aa protein consisting of six Arm-like domains which are similar to a DUF463 domain, and an N-terminal region including a transmembrane domain.

면역원

Armadillo repeat-containing X-linked protein 3 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

Arm-containing protein lost in epithelial cancers linked to the X chromosome (Alex3) regulates mitochondrial trafficking in neurons. The N-terminal region of this protein takes part in mitochondrial targeting and aggregation. ARMCX3 also plays a role as putative tumor suppressor. Interaction of ARMCX3 with Sox10 transcription factor has been suggested to increase the signal transduction cascade between the nucleus and mitochondria.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74069

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)