콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV54586

Sigma-Aldrich

Anti-ACADSB antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-2-MEBCAD, Anti-ACAD7, Anti-Acyl-coenzyme A dehydrogenase, short/branched chain, Anti-SBCAD

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩931,669

₩931,669


예상 입고일2025년 4월 09일세부사항



크기 선택

보기 변경
100 μL
₩931,669

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩931,669


예상 입고일2025년 4월 09일세부사항


생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

44 kDa

종 반응성

human, rat, mouse, bovine

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ACADSB(36)

면역원

Synthetic peptide directed towards the middle region of human ACADSB

애플리케이션

Anti-ACADSB antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

생화학적/생리학적 작용

The protein encoded by ACADSB (Acyl-coenzyme A dehydrogenase, short/branched chain) gene belongs to acyl-CoA dehydrogenases (ACADs) family and is mapped on to chromosome 10 at 10q25-q26. It is a homotetramer with each monomer comprising of a non-covalently bound flavin adenine dinucleotide (FAD) molecule as a cofactor. It catalyzes the initial step of mitochondrial fatty acid β-oxidation for substrates with four and six carbons. ACADSB also catalyzes the third step of leucine and isoleucine/valine metabolism. Deficiency of the encoded protein increases 2-methylbutyrylglycine and 2-methylbutyrylcarnitine in blood and urine and results in catabolism of L-isoleucine.

서열

Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

B Binzak et al.
Biochimica et biophysica acta, 1382(1), 137-142 (1998-03-21)
The acyl-CoA dehydrogenases (ACDs) are a family of related enzymes which catalyze the alpha,beta-dehydrogenation of acyl-CoA esters, transferring electrons to electron transferring flavoprotein. We have recently cloned and characterized the cDNA for human short/branched chain acyl-CoA dehydrogenase (SBCAD). Based on
K M Gibson et al.
Pediatric research, 47(6), 830-833 (2000-06-01)
An 4-mo-old male was found to have an isolated increase in 2-methylbutyrylglycine (2-MBG) and 2-methylbutyrylcamitine (2-MBC) in physiologic fluids. In vitro oxidation studies in cultured fibroblasts using 13C- and 14C-labeled branched chain amino acids indicated an isolated block in 2-methylbutyryl-CoA
Amy K Saenger et al.
Biochemistry, 44(49), 16043-16053 (2005-12-08)
Human short-chain acyl-CoA dehydrogenase (hSCAD) catalyzes the first matrix step in the mitochondrial beta-oxidation cycle for substrates with four and six carbons. Previous studies have shown that the act of substrate/product binding induces a large enzyme potential shift in acyl-CoA
P Deloukas et al.
Nature, 429(6990), 375-381 (2004-05-28)
The finished sequence of human chromosome 10 comprises a total of 131,666,441 base pairs. It represents 99.4% of the euchromatic DNA and includes one megabase of heterochromatic sequence within the pericentromeric region of the short and long arm of the

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.