콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV53597

Sigma-Aldrich

Anti-INHA antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-Inhibin, α

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩701,162

₩701,162


예상 입고일2025년 7월 18일세부사항



크기 선택

보기 변경
100 μL
₩701,162

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩701,162


예상 입고일2025년 7월 18일세부사항


생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

40 kDa

종 반응성

bovine, goat, sheep, human, pig

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... INHA(3623)

일반 설명

NHA (inhibin, alpha) gene encodes the alpha subunit of inhibins A and B protein complexes that belongs to TGF-beta family. It is localized in the syncytiotrophoblast and the intermediate trophoblast of the placenta and may play a role in the mechanism of labor. INHA is also known as Inhibin α. Activin and inhibin are two closely related protein complexes involved in follicle-stimulating hormone (FSH) synthesis. They are produced in the gonads, pituitary gland, placenta, corpus luteum and other organs.

면역원

Synthetic peptide directed towards the N terminal region of human INHA

애플리케이션

Anti-INHA antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

생화학적/생리학적 작용

Inhibins facilitates the regulation of numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Loss of expression of inhibinα results in high grade prostate cancer. Follicle-stimulating hormone (FSH) stimulates the secretion of inhibin from the granulosa cells of the ovarian follicles in the ovaries. In turn, inhibin suppresses FSH. Inhibin secretion is diminished by GHRH, and enhanced by insulin-like growth factor-1. Inhibin may involve competing with activin for binding to activin receptors and binding to inhibin-specific receptors. Activin, inhibin and follistatin participate as intraovarian regulatory molecules involved in follicular cell proliferation, differentiation, steroidogenesis, oocyte maturation and corpus luteum function.

서열

Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Matías L Stangaferro et al.
Animal reproduction science, 148(3-4), 97-108 (2014-07-09)
Cystic ovarian disease (COD) is an important cause of infertility in dairy cattle. Although many researchers have focused their work on the endocrine changes related to this disease, evidence indicates that intraovarian components play an important role in follicular persistence.
Stefano Luisi et al.
Human reproduction update, 11(2), 123-135 (2004-12-25)
A great deal of new information has arisen in the recent years concerning inhibin physiology and clinical relevance in reproductive medicine. It is now recognized that the two inhibin isoforms, named inhibin A and inhibin B, are produced by the
P van Zonneveld et al.
Human reproduction (Oxford, England), 18(3), 495-501 (2003-03-05)
The cause of declining fertility with age, in women who still have regular menstrual cycles, is not clear. Follicle development, endometrial growth and hormonal patterns were evaluated in cycles of older women (aged 41-46 years; n = 26) who previously
G M Lambert-Messerlian et al.
Molecular and cellular endocrinology, 225(1-2), 101-108 (2004-09-29)
To date, the only routine clinical application of inhibin or activin measurement in testing for fetal abnormalities has been the use of inhibin A in prenatal screening for trisomy 21 (Down syndrome). Second trimester maternal serum levels of inhibin A
S L Mellor et al.
The Journal of clinical endocrinology and metabolism, 83(3), 969-975 (1998-03-20)
Serum inhibin levels are elevated in postmenopausal women with granulosa and mucinous epithelial tumors of the ovary. In contrast, functional deletion of the inhibin alpha gene in male and female mice results in the development of primary gonadal granulosa/Sertoli cell

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.