Synthetic peptide directed towards the N terminal region of human KLHDC1
생화학적/생리학적 작용
KLHDC1 contains 6 Kelch repeats. KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells. The exact function of KLHDC1 remains unknown.
서열
Synthetic peptide located within the following region: IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.