AV51692
Anti-MICALL1 antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-DKFZp686M2226, Anti-FLJ45921, Anti-KIAA1668, Anti-MICAL-L1, Anti-MICAL-like 1, Anti-MIRAB13
로그인조직 및 계약 가격 보기
크기 선택
100 μL
₩618,643
₩618,643
예상 입고일2025년 5월 15일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
모든 사진(4)
크기 선택
보기 변경
100 μL
₩618,643
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩618,643
예상 입고일2025년 5월 15일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
93 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MICALL1(85377)
면역원
Synthetic peptide directed towards the N terminal region of human MICALL1
애플리케이션
Anti-MICALL1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
생화학적/생리학적 작용
Molecule Interacting with CasL (MICAL)-like1 (MICALL1) is an endocytic regulatory protein that interacts with GTP-binding proteins such as Rab35. This interaction enhances the localization of MICALL1 to tubular recycling endosomes. MICALL1 also interacts with Rab13 and mediates the endocytosis of epidermal growth factor and regulates assembly of tight junction in the epithelial cells.
서열
Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Juliati Rahajeng et al.
Traffic (Copenhagen, Denmark), 13(1), 82-93 (2011-09-29)
Endocytosis is a conserved process across species in which cell surface receptors and lipids are internalized from the plasma membrane. Once internalized, receptors can either be degraded or be recycled back to the plasma membrane. A variety of small GTP-binding
Anne-Marie Marzesco et al.
Molecular biology of the cell, 13(6), 1819-1831 (2002-06-12)
Junctional complexes such as tight junctions (TJ) and adherens junctions are required for maintaining cell surface asymmetry and polarized transport in epithelial cells. We have shown that Rab13 is recruited to junctional complexes from a cytosolic pool after cell-cell contact
Nancy Abou-Zeid et al.
Molecular biology of the cell, 22(18), 3431-3441 (2011-07-29)
Small GTPase Rabs are required for membrane protein sorting/delivery to precise membrane domains. Rab13 regulates epithelial tight junction assembly and polarized membrane transport. Here we report that Molecule Interacting with CasL (MICAL)-like1 (MICAL-L1) interacts with GTP-Rab13 and shares a similar
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
