AV51203

Anti-OLFM4 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-GC1, Anti-GW112, Anti-KIAA4294, Anti-OlfD, Anti-Olfactomedin 4, Anti-bA209J19.1
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 55 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_006409
• UniProt 수납 번호: Q6UX06
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... OLFM4(10562)

설명

일반 설명

Olfactomedin-4 (OLFM4), an olfactomedin domain-containing protein, belongs to the olfactomedin-related protein family. OLFM4 is found in the cytoplasm, mitochondria, and membrane including, other subcellular compartments. It is a disulfide-bonded multimer with a signal peptide and six N-linked glycosylation motifs. OLFM4 has a coil-coil domain at the N-terminus and an olfactomedin domain at the C-terminus. Endogenous expression of the OLFM4 protein is seen in mature neutrophils and gastric and intestinal epithelial cells. It is expressed ubiquitously in intestinal crypts and is secreted extracellularly. OLFM4 gene is located on human chromosome 13q14.3.

면역원

Synthetic peptide directed towards the C terminal region of human OLFM4

애플리케이션

Anti-OLFM4 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

생화학적/생리학적 작용

Olfactomedin 4 (OLFM4) has a role in tumor growth. OLFM4 has been identified as an anti-apoptotic factor and an extracellular matrix (ECM) glycoprotein.

Olfactomedin-4 (OLFM4) can mediate cell adhesion by binding to cadherins and lectins. It may play a role in the defense of the gastrointestinal mucosal surface. Overexpression of the OLFM4 mRNA is observed in gastric and colon cancer patients. In the human intestine, OLFM4 is considered a powerful marker for stem cells.

서열

Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable