AV50240
Anti-MOGAT1 antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-DGAT2L, Anti-DGAT2L1, Anti-MGAT1, Anti-Monoacylglycerol O-acyltransferase 1
로그인조직 및 계약 가격 보기
크기 선택
100 μL
₩824,891
₩824,891
예상 입고일2025년 6월 18일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
모든 사진(2)
크기 선택
보기 변경
100 μL
₩824,891
About This Item
₩824,891
예상 입고일2025년 6월 18일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
39 kDa
종 반응성
mouse, pig, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MOGAT1(116255)
면역원
Synthetic peptide directed towards the C terminal region of human MOGAT1
애플리케이션
Anti-MOGAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
생화학적/생리학적 작용
Monoacylglycerol O-acyltransferase 1 (MOGAT1) catalyzes the synthesis of diacylglycerols that in turn act as precursors for the triacylglycerols and phospholipids. MOGAT enzymes are highly expressed in the liver; hepatic MOGAT1 is a potential therapeutic target for metabolic disorders such as obesity, steatosis and type 2 diabetes mellitus.
서열
Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Angela M Hall et al.
Journal of lipid research, 53(5), 990-999 (2012-03-08)
Intrahepatic lipid accumulation is extremely common in obese subjects and is associated with the development of insulin resistance and diabetes. Hepatic diacylglycerol and triacylglycerol synthesis predominantly occurs through acylation of glycerol-3-phosphate. However, an alternative pathway for synthesizing diacylglycerol from monoacylglycerol
Yasuhiro Hayashi et al.
Molecular therapy. Nucleic acids, 3, e154-e154 (2014-03-20)
Over the past decade, considerable advances have been made in the discovery of gene targets in metabolic diseases. However, in vivo studies based on molecular biological technologies such as the generation of knockout mice and the construction of short hairpin
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
