Synthetic peptide directed towards the middle region of Human LRRC59
애플리케이션
Anti-LRRC59 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.
생화학적/생리학적 작용
Leucine rich repeat containing 59 (LRRC59) is a ribosome receptor localized to endoplasmic reticulum. It also acts as an intracellular binding partner of Fibroblast growth factor 1 (FGF1) and regulates its nuclear import.
서열
Synthetic peptide located within the following region: KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Fibroblast growth factor 1 (FGF1) taken up by cells into endocytic vesicles can be translocated across vesicular membranes into the cytosol and the nucleus where it has a growth regulatory activity. Previously, leucine-rich repeat containing 59 (LRRC59) was identified as
질문
후기
★★★★★ 평점 값 없음
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..