AV49316

Anti-TEX2 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-DKFZp781G0721, Anti-HT008, Anti-KIAA1738, Anti-TMEM96, Anti-Testis expressed 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 126 kDa
• 종 반응성: rat, guinea pig, bovine, rabbit, mouse, human, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_060939
• UniProt 수납 번호: Q8IWB9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TEX2(55852)

설명

면역원

Synthetic peptide directed towards the N terminal region of human TEX2

애플리케이션

Anti-TEX2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

생화학적/생리학적 작용

Testis expressed 2 (TEX2; HT008) is a chaperone protein containing SMP domain that regulates sphingolipid metabolism.

서열

Synthetic peptide located within the following region: KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable