콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

AV49134

Sigma-Aldrich

Anti-SULT1A1 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-HAST1/HAST2, Anti-MGC131921, Anti-MGC5163, Anti-P-PST, Anti-PST, Anti-ST1A3, Anti-STP, Anti-Sulfotransferase family, cytosolic, 1A, phenol-preferRing, member 1

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩824,891

₩824,891


예상 입고일2025년 5월 15일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요


크기 선택

보기 변경
100 μL
₩824,891

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩824,891


예상 입고일2025년 5월 15일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

34 kDa

종 반응성

human, horse, rabbit, bovine

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SULT1A1(6817)

면역원

Synthetic peptide directed towards the N terminal region of human SULT1A1

애플리케이션

Anti-SULT1A1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

생화학적/생리학적 작용

Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1) is a phenol sulfotransferase with thermostable activity. The members of sulfotransferase family localize to cytoplasm and catalyze the sulfate conjugation of hormones, xenobiotic compounds, drugs and neurotransmitters.

서열

Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

S J Hebbring et al.
Cytogenetic and genome research, 123(1-4), 205-210 (2008-01-01)
Pharmacogenetics is the study of the role of inheritance in variation to drug response. Drug response phenotypes can vary from adverse drug reactions at one end of the spectrum to equally serious lack of the desired effect of drug therapy
M W H Coughtrie
The pharmacogenomics journal, 2(5), 297-308 (2002-11-20)
Members of the cytosolic sulfotransferase (SULT) superfamily catalyse the sulfation of a multitude of xenobiotics, hormones and neurotransmitters. Humans have at least 10 functional SULT genes, and a number of recent advances reviewed here have furthered our understanding of SULT
Philip M Probert et al.
Toxicology letters, 243, 98-110 (2016-01-08)
Rat B-13 progenitor cells are readily converted into functional hepatocyte-like B-13/H cells capable of phase I cytochrome P450-dependent activation of pro-carcinogens and induction of DNA damage. The aim of the present study was to investigate whether the cells are also

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.