AV49111
Anti-C3ORF64 antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-AER61, Anti-FLJ13078, Anti-FLJ33770, Anti-FLJ41219, Anti-MGC34132
로그인조직 및 계약 가격 보기
크기 선택
100 μL
₩618,643
₩618,643
예상 입고일2025년 5월 22일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
모든 사진(1)
크기 선택
보기 변경
100 μL
₩618,643
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩618,643
예상 입고일2025년 5월 22일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
52 kDa
종 반응성
human, guinea pig, mouse, rat, horse, dog, rabbit, bovine
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... C3orf64(285203)
면역원
Synthetic peptide directed towards the C terminal region of human C3orf64
애플리케이션
Anti-C3ORF64 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
생화학적/생리학적 작용
C3ORF64 is popular as EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase (EOGT; AOS4) is an O-GlcNAc transferase located in the endoplasmic reticulum. It catalyzes the addition of β-linked GlcNAc on Ser or Thr of EGF repeats. Mutations in EOGT gene reportedly result in genetic heterogeneity of Adams-Oliver Syndrome.
서열
Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Joshua F Alfaro et al.
Proceedings of the National Academy of Sciences of the United States of America, 109(19), 7280-7285 (2012-04-21)
O-linked N-acetylglucosamine (O-GlcNAc) is a reversible posttranslational modification of Ser and Thr residues on cytosolic and nuclear proteins of higher eukaryotes catalyzed by O-GlcNAc transferase (OGT). O-GlcNAc has recently been found on Notch1 extracellular domain catalyzed by EGF domain-specific OGT.
Ranad Shaheen et al.
American journal of human genetics, 92(4), 598-604 (2013-03-26)
Adams-Oliver syndrome (AOS) is a rare, autosomal-dominant or -recessive disorder characterized primarily by aplasia cutis congenita and terminal transverse limb defects. Recently, we demonstrated that homozygous mutations in DOCK6 cause an autosomal-recessive form of AOS. In this study, we sought
Reto Müller et al.
PloS one, 8(5), e62835-e62835 (2013-05-15)
The O-GlcNAc transferase Eogt modifies EGF repeats in proteins that transit the secretory pathway, including Dumpy and Notch. In this paper, we show that the Notch ligands Delta and Serrate are also substrates of Eogt, that mutation of a putative
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
