콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV48224

Sigma-Aldrich

Anti-TPM2 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-AMCD1, Anti-DA1, Anti-TMSB, Anti-TropoMyosin 2 (β)

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩538,458

₩538,458


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩538,458

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩538,458


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

33 kDa

종 반응성

human, rabbit, dog, rat, mouse, bovine

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... TPM2(7169)

일반 설명

TPM2 codes for beta-tropomyosin that belongs to the actin binding protein family. Mutations in TPM2 have been linked to congenital myopathies, Sheldon-Hall syndrome and cap disease.
Rabbit anti-TPM2 antibody recognizes canine, bovine, rabbit, zebrafish, chicken, human, mouse, and rat TPM2

면역원

Synthetic peptide directed towards the C terminal region of human TPM2

애플리케이션

Rabbit anti-TPM2 antibodies have been used for immunoblot analysis. It is also suitable for IHC applications at a concentration of 4-8 μg/ml.

생화학적/생리학적 작용

TPM2 is beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers (Tajsharghi et al., 2007 [PubMed 17846275]). See also TPM1 (MIM 191010), TPM3 (MIM 191030), and TPM4 (MIM 600317).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

서열

Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Minttu Marttila et al.
Human mutation, 35(7), 779-790 (2014-04-03)
Mutations affecting skeletal muscle isoforms of the tropomyosin genes may cause nemaline myopathy, cap myopathy, core-rod myopathy, congenital fiber-type disproportion, distal arthrogryposes, and Escobar syndrome. We correlate the clinical picture of these diseases with novel (19) and previously reported (31)
Jung Min Ko et al.
Journal of Korean medical science, 28(5), 780-783 (2013-05-17)
Sheldon-Hall syndrome (SHS) is a rare autosomal dominant, inherited arthrogryposis syndrome characterized by multiple congenital contractures of the distal limbs. To date, four genes that encode the skeletal muscle fiber complex have been confirmed as the causative genes. Mutations in
Vilma-Lotta Lehtokari et al.
Neuromuscular disorders : NMD, 17(6), 433-442 (2007-04-17)
"Cap myopathy" or "cap disease" is a congenital myopathy characterised by cap-like structures at the periphery of muscle fibres, consisting of disarranged thin filaments with enlarged Z discs. Here we report a deletion in the beta-tropomyosin (TPM2) gene causing cap
Carole L Moncman et al.
Experimental cell research, 319(3), 23-31 (2012-11-24)
Extraocular muscles are a unique subset of striated muscles. During postnatal development, the extraocular muscles undergo a number of myosin isoform transitions that occur between postnatal day P10 (P10) and P15. These include: (1) loss of embryonic myosin from the

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.