콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV48203

Sigma-Aldrich

Anti-ENO3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Enolase 3 (β, muscle), Anti-MSE

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩457,664

₩457,664


예상 입고일2025년 5월 02일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요


크기 선택

보기 변경
100 μL
₩457,664

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩457,664


예상 입고일2025년 5월 02일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

47 kDa

종 반응성

goat, rat, dog, horse, rabbit, mouse, guinea pig, bovine, human

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ENO3(2027)

일반 설명

Enolase 3 (ENO3) is a skeletal muscle isoenzyme that is involved in muscle development. ENO3 transcription is regulated by muscle-specific enhancer proteins. Mutations in ENO3 have been linked to glycogen storage diseases.
Rabbit Anti-ENO3 antibody recognizes bovine, canine, rabbit, human, mouse, and rat ENO3.

면역원

Synthetic peptide directed towards the N terminal region of human ENO3

애플리케이션

Rabbit Anti-ENO3 antibody is suitable for western blot applications at 5 μg/ml and for IHC at 4-8 μg/ml.

생화학적/생리학적 작용

ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR.

서열

Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

S Feo et al.
Molecular and cellular biology, 15(11), 5991-6002 (1995-11-01)
To provide evidence for the cis-regulatory DNA sequences and trans-acting factors involved in the complex pattern of tissue- and stage-specific expression of the beta enolase gene, constructs containing fragments of the gene fused to the chloramphenicol acetyltransferase gene were used

질문

  1. Sir, Can be use this antibody for ELISA for detecting ENO3 in saliva?

    1 답변
    1. Unfortunately, this product has not been tested for use in ELISA. The end user would have to determine suitability.

      도움이 되었습니까?

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.