AV47876

Anti-LAB antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-BG:DS00004.9, Anti-CG1264, Anti-DmLab, Anti-Dmel_CG1264, Anti-EfR9, Anti-F121, Anti-F24
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 54 kDa
• 종 반응성: human, Drosophila
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_476613
• UniProt 수납 번호: P10105
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: Drosophila melanogaster ... lab(40817)

설명

일반 설명

Labial (LAB) is a Drosophila transcription factor that regulates brain, midgut and embryo development. It is also known to modulate cell fate decisions and cell differentiation.
Rabbit Anti-LAB antibody recognizes Drosophila LAB.

면역원

Synthetic peptide corresponding to a region of Fruit fly

애플리케이션

Rabbit Anti-LAB antibody is suitable for western blot applications at a concentration of 1μg/ml and for IHC at 4-8μg/ml.

생화학적/생리학적 작용

lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

서열

Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable