AV46276
Anti-ASF1B antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-ASF1 anti-silencing function 1 homolog B (S. cerevisiae), Anti-CIA-II, Anti-FLJ10604
로그인조직 및 계약 가격 보기
크기 선택
100 μL
₩618,643
₩618,643
예상 입고일2025년 3월 21일세부사항
모든 사진(1)
크기 선택
보기 변경
100 μL
₩618,643
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩618,643
예상 입고일2025년 3월 21일세부사항
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
22 kDa
종 반응성
rat, guinea pig, mouse, human, bovine, dog
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ASF1B(55723)
면역원
Synthetic peptide directed towards the middle region of human ASF1B
애플리케이션
Anti-ASF1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.
생화학적/생리학적 작용
ASF1B [anti-silencing function 1 homolog B (S. cerevisiae)] gene encodes for a protein that belongs to H3/H4 family of histone chaperone proteins and facilitates the histone deposition as well as histone exchange and removal during nucleosome assembly and disassembly. ASF1B interacts with HCF-1 and regulates the progression of cellular DNA replication forks through chromatin reorganization. It also stimulates the viral DNA replication by combining Asf1b to DNA replication components. Additionally, depletion of both the histone chaperones ASF1a and ASF1b in human cells induces hallmark of alternative lengthening of telomeres (ALT) in primary as well as cancer cells.
서열
Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Angélique Galvani et al.
Molecular and cellular biology, 28(11), 3672-3685 (2008-04-02)
Histone chaperones have been implicated in nucleosome assembly and disassembly as well as histone modification. ASF1 is a highly conserved histone H3/H4 chaperone that synergizes in vitro with two other histone chaperones, chromatin assembly factor 1 (CAF-1) and histone repression
Hua Peng et al.
Proceedings of the National Academy of Sciences of the United States of America, 107(6), 2461-2466 (2010-02-06)
The cellular transcriptional coactivator HCF-1 interacts with numerous transcription factors as well as other coactivators and is a component of multiple chromatin modulation complexes. The protein is essential for the expression of the immediate early genes of both herpes simplex
Roderick J O'Sullivan et al.
Nature structural & molecular biology, 21(2), 167-174 (2014-01-15)
The mechanism of activation of the alternative lengthening of telomeres (ALT) pathway of mammalian chromosome-end maintenance has been unclear. We have now discovered that co-depletion of the histone chaperones ASF1a and ASF1b in human cells induced all hallmarks of ALT
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
