Synthetic peptide directed towards the N terminal region of human KYNU
애플리케이션
Anti-KYNU (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.
생화학적/생리학적 작용
KYNU gene encodes a pyridoxal-5′-phosphate-(pyridoxal-P)-dependent enzyme, Kynureninase that catalyzes the cleavage of L-kynurenine into anthranilic acid and L-3-hydroxykynurenine into 3-hydroxyanthranilic acid. It facilitates the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.
서열
Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
European journal of biochemistry, 239(2), 460-468 (1996-07-15)
Kynureninase (L-kynurenine hydrolase), a pyridoxal-5'-phosphate-(pyridoxal-P)-dependent enzyme, catalyses the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. In this report, we describe the isolation of a cDNA clone encoding human kynureninase. Degenerate oligonucleotides designed from the amino acid
Kynureninase [E.C.3.7.1.3.] is one of the enzymes involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. By tryptic and CNBr digestion of purified rat liver kynureninase, we obtained about 28% of the amino acid sequence of
질문
후기
★★★★★ 평점 값 없음
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..