AV44054

Anti-SLC25A28 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-DKFZp547C109, Anti-MFRN2, Anti-MRS3/4, Anti-MRS4L, Anti-NPD016, Anti-Solute carrier family 25, member 28
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 39 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_112489
• UniProt 수납 번호: Q96A46
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC25A28(81894)

설명

면역원

Synthetic peptide directed towards the C terminal region of human SLC25A28

애플리케이션

Anti-SLC25A28 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

생화학적/생리학적 작용

SLC25A28 also known as mitoferrin 2 (MFRN2) belongs to mitochondrial solute carrier family.It transports mitochondrial iron into the developing erythrocytes. High concentrations of iron are highly toxic; the regulation of iron transport in the vertebrate cells by MFRN1 and 2 is therefore critical.

서열

Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable