AV42290

Anti-AGR2 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-AG2, Anti-Anterior gradient homolog 2 (Xenopus laevis), Anti-GOB-4, Anti-HAG-2, Anti-XAG-2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 20 kDa
• 종 반응성: rat, dog, rabbit, human, bovine, horse, mouse, guinea pig
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_006399
• UniProt 수납 번호: O95994
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... AGR2(10551)

설명

일반 설명

Anterior gradient homolog 2 (Xenopus laevis) (AGR2) is a protein disulfide isomerase (PDI) which aids protein folding and assembly by catalyzing formation and shuffling of cysteine disulfide bonds in the endoplasmic reticulum (ER). AGR2 is present in the ER of intestinal secretory epithelial cells and it is believed to have a role in mucin processing and colitis.

특이성

Anti-AGR2 antibody polyclonal antibody reacts with the bovine, chicken, zebrafish, human, mouse, and rat anterior gradient homolog 2 (Xenopus laevis).

면역원

Synthetic peptide directed towards the middle region of human AGR2

애플리케이션

Anti-anterior gradient homolog 2 (Xenopus laevis) polyclonal antibody is used to tag anterior gradient homolog 2 (Xenopus laevis) protein(s)/subunits for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.

생화학적/생리학적 작용

AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.

서열

Synthetic peptide located within the following region: AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable