AV38090

Anti-EGR4 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Early growth response 4
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 51 kDa
• 종 반응성: rat, horse, mouse, dog, rabbit, bovine, human, guinea pig
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_001956
• UniProt 수납 번호: Q05215
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EGR4(1961)

설명

일반 설명

Early growth response (Egr) proteins are transcriptional regulators (Egr1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 4 (EGR4, NGFI-C, pAT133), a member of the Egr family of zinc-finger transcription factors, regulates early stage meiosis and functions as a master gene transcription regulator of processes such as spermatogenesis and male fertility. Egr4 is an important component in the mechanism for trophic factor-mediated upregulation of K-Cl cotransporter (KCC2) in immature neurons.

특이성

Anti-EGR4 polyclonal antibody reacts with human, mouse, rat, canine, zebrafish, bovine, and chicken early growth response 4 proteins.

면역원

Synthetic peptide directed towards the C terminal region of human EGR4

애플리케이션

Anti-EGR4 polyclonal antibody is used to tag early growth response 4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of early growth response 4 protein in spermatogenesis and male fertility.

생화학적/생리학적 작용

The nerve growth factor-induced clone C (NGFI-C/EGR4) gene is a zinc-finger transcription factor that is rapidly induced by nerve growth factor in rat pheochromocytoma PC12 cells and by seizure in brain. NGFI-C/EGR4 is closely related to the previously described early response genes, nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR-4 functionally cooperate with NFAT proteins and induce expression of IL-2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.

서열

Synthetic peptide located within the following region: RSDHLTSHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEER

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable