₩403,869
예상 입고일2025년 3월 26일세부사항
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
45 kDa
종 반응성
mouse, rat, human, rabbit, pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CHD1L(9557)
면역원
Synthetic peptide directed towards the middle region of human CHD1L
생화학적/생리학적 작용
Chromodomain helicase DNA binding protein 1-like (CHD1L) is a DNA helicase and chromatin remodeling factor that is important in DNA repair. It converts ATP to poly (ADP-ribose) and regulates the chromatin relaxation during DNA repair. It has been identified as an oncogene that induces cell proliferation, apoptosis inhibition, G1/S phase transition and embryo development. CHD1L acts as a marker for prognosis of solid tumors such as hepatocellular carcinoma.[1]
서열
Synthetic peptide located within the following region: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Wen Cheng et al.
Molecular cancer, 12(1), 170-170 (2013-12-24)
Comprehensive sequencing efforts have revealed the genomic landscapes of common forms of human cancer and - 140 driver genes have been identified, but not all of them have been extensively investigated. CHD1L (chromodomain helicase/ATPase DNA binding protein 1-like gene) or
Jiyeon Hyeon et al.
Korean journal of pathology, 47(1), 9-15 (2013-03-14)
The gene for chromodomain helicase/ATPase DNA binding protein 1-like (CHD1L) was recently identified as a target oncogene within the 1q21 amplicon, which occurs in 46% to 86% of primary hepatocellular carcinoma (HCC) cases. However, the prognostic significance of CHD1L in
Alyssa C Snider et al.
Biology open, 2(2), 121-131 (2013-02-23)
During preimplantation development, the embryo must establish totipotency and enact the earliest differentiation choices, processes that involve extensive chromatin modification. To identify novel developmental regulators, we screened for genes that are preferentially transcribed in the pluripotent inner cell mass (ICM)
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
