추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
61 kDa
종 반응성
human, rat, rabbit, guinea pig, horse, mouse, bovine
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... EBF2(64641)
면역원
Synthetic peptide directed towards the C terminal region of human EBF2
생화학적/생리학적 작용
EBF2 belongs to the EBF/COE family of transcription factors that contain well-conserved DNA-binding domain. EBF factors play important regulatory roles in various developmental processes and in differentiation of osteoblasts. EBF2 is critical in the generation and migration of Cajal-Retzius neurons during early cortical neurogenesis in cerebral cortex.
서열
Synthetic peptide located within the following region: VPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Francesca Chiara et al.
Developmental biology, 365(1), 277-289 (2012-03-17)
Cajal-Retzius (CR) cells play a crucial role in the formation of the cerebral cortex, yet the molecules that control their development are largely unknown. Here, we show that Ebf transcription factors are expressed in forebrain signalling centres-the septum, cortical hem
Shu-Mien Chuang et al.
Developmental neuroscience, 33(6), 479-493 (2011-11-02)
Mammalian cortical neurogenesis occurs on a precise time schedule during development. The earliest born neurons form the preplate and later separate into layer 1, which includes Cajal-Retzius (C-R) neurons, and the subplate. The preplate and its derivatives play a critical
Ana Patiño-García et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 15(16), 5082-5091 (2009-08-13)
Osteosarcoma is the most prevalent bone tumor in children and adolescents. At present, the mechanisms of initiation, maintenance, and metastasis are poorly understood. The purpose of this study was to identify relevant molecular targets in the pathogenesis of osteosarcoma. Tumor
S S Wang et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 17(11), 4149-4158 (1997-06-01)
The Olf-1/EBF helix-loop-helix (HLH) transcription factor has been implicated in olfactory gene regulation and in B-cell development. Using homology screening methods, we identified two additional Olf-1/EBF-like cDNAs from a mouse embryonic cDNA library. The Olf-1/EBF-like (O/E) proteins O/E-1, O/E-2, and
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.