Synthetic peptide directed towards the C terminal region of human ETV7
생화학적/생리학적 작용
ETV7 belongs to the ETS family of transcription factors that are important in development, differentiation and oncogenesis. It is predominantly expressed in hematopoietic tissues and promotes lymphomagenesis along with Myc. ETV7 was reported to regulate red blood cell development in zebrafish via the cholesterol synthesis pathway.
서열
Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
TEL2/ETV7 is highly homologous to the ETS transcription factor TEL/ETV6, a frequent target of chromosome translocation in human leukemia. Although both proteins are transcriptional inhibitors binding similar DNA recognition sequences, they have opposite biologic effects: TEL inhibits proliferation while TEL2
Zebrafish etv7 regulates red blood cell development through the cholesterol synthesis pathway.
Quintana AM, Picchione F, Klein Geltink RI, et al.
Disease models & mechanisms (2013)
질문
후기
★★★★★ 평점 값 없음
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..