Synthetic peptide directed towards the N terminal region of human TRIP13
생화학적/생리학적 작용
TRIP13 protein is a hormone-dependent transcription factor. It interacts with the ligand-binding domain of thyroid hormone receptors.
서열
Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. To help elucidate the mechanisms that underlie this transcriptional regulation and other potential TR activities, we used the yeast interaction
질문
후기
★★★★★ 평점 값 없음
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..