콘텐츠로 건너뛰기
Merck
모든 사진(1)

문서

AV34760

Sigma-Aldrich

Anti-PHF17 (AB2) antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-FLJ22479, Anti-JADE1, Anti-KIAA1807, Anti-PHD finger protein 17

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

58 kDa

종 반응성

bovine, rat, guinea pig, horse, human, mouse, rabbit, dog

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PHF17(79960)

일반 설명

PHF17 (PHD finger protein 17) is a short-lived, kidney-enriched Jade protein consisting of canonical plant homeodomain (PHD) finger protein and a non-canonical extended PHD with zinc-binding ability. It is localized in the nucleus and is highly expressed in kidney and renal proximal tubule cells. Rabbit Anti-PHF17 antibody recognizes human, mouse, rat, bovine, and chicken PHF17.

면역원

Synthetic peptide directed towards the C terminal region of human PHF17

애플리케이션

Rabbit Anti-PHF17 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Rabbit Anti-PHF17 antibody is suitable for western blot applications.

생화학적/생리학적 작용

PHF17 (PHD finger protein 17) is associated with several cellular activities such as chromatin remodeling, renal tubular epithelial cell differentiation, growth suppression, apoptosis and protein-protein interactions. It possesses transcriptional and endogenous histone acetyltransferase (HAT) activity. It acts as a transcriptional co-activator in the TIP60 mediated histone H4/H2A specific HAT activity. It has been reported that PHF17 may play a role in the renal cancer and von Hippel-Lindau disease. PHF17 also possesses tumour suppressor property. In the renal tumorigenesis, it controls canonical Wnt signaling pathway by ubiquitylating oncoprotein β-catenin in Wnt-responsive manner.

서열

Synthetic peptide located within the following region: EPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our 제품 선택기 도구.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Vipul C Chitalia et al.
Nature cell biology, 10(10), 1208-1216 (2008-09-23)
The von Hippel-Lindau protein pVHL suppresses renal tumorigenesis in part by promoting the degradation of hypoxia-inducible HIF-alpha transcription factors; additional mechanisms have been proposed. pVHL also stabilizes the plant homeodomain protein Jade-1, which is a candidate renal tumour suppressor that
Maria V Panchenko et al.
The Journal of biological chemistry, 279(53), 56032-56041 (2004-10-27)
Jade-1 was identified as a protein partner of the von Hippel-Lindau tumor suppressor pVHL. The interaction of Jade-1 and pVHL correlates with renal cancer risk. We have investigated the molecular function of Jade-1. Jade-1 has two zinc finger motifs called

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.