AV34382

Anti-NFKBIB antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, β
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 38 kDa
• 종 반응성: rabbit, mouse, human, rat, guinea pig
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_002494
• UniProt 수납 번호: Q15653
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... NFKBIB(4793)

설명

일반 설명

NFKBIB is a NF-κB inhibitor that forms a complex with NF-κB and traps it in the cytoplasm. Serine phosphorylation in NFKBIB proteins activates its ubiquitin-mediated degradation. This subsequently facilitates the nuclear transport and functions of NF-κB proteins.
Rabbit Anti-NFKBIB antibody recognizes human, mouse, rat, canine, and bovine NFKBIB.

면역원

Synthetic peptide directed towards the N terminal region of human NFKBIB

애플리케이션

Rabbit Anti-NFKBIB antibody can be used for western blot applications at a concentration of 0.5 μg/ml.

생화학적/생리학적 작용

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].

서열

Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable