추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
23 kDa
종 반응성
human, dog, sheep, horse, bovine, guinea pig
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CLDN1(9076)
일반 설명
Claudin-1 (CLDN1) membrane protein belongs to the claudin family. It comprises four membrane-spanning regions, N- and C-terminal cytoplasmic domains, and two extracellular loops. The CLDN1 gene is mapped to human chromosome 3q28. It is expressed in the kidney, testis, intestine, brain, and liver.
면역원
Synthetic peptide directed towards the C terminal region of human CLDN1
생화학적/생리학적 작용
Claudin-1 (CLDN1) is a key component of the tight junctions that mediate epithelial barrier functions. CLDN1 is dichotomous as it is downregulated in breast, esophageal and prostate cancer. The gene is overexpressed in oral squamous cell cancer, colon, nasopharyngeal and ovarian tumors. It is implicated in neonatal sclerosing cholangitis (NISCH) syndrome. CLDN1 is involved in dengue (DENV) entry and acts as a co-receptor for hepatitis C virus (HCV) entry.
서열
Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Ajaz A Bhat et al.
International journal of molecular sciences, 21(2) (2020-01-19)
Claudins, a group of membrane proteins involved in the formation of tight junctions, are mainly found in endothelial or epithelial cells. These proteins have attracted much attention in recent years and have been implicated and studied in a multitude of
Pulin Che et al.
Virology, 446(1-2), 303-313 (2013-10-01)
Dengue disease is becoming a huge public health concern around the world as more than one-third of the world's population living in areas at risk of infection. In an effort to assess host factors interacting with dengue virus, we identified
Anne A Blanchard et al.
PloS one, 11(9), e0163387-e0163387 (2016-09-21)
The claudin 1 tight junction protein, solely responsible for the barrier function of epithelial cells, is frequently down regulated in invasive human breast cancer. The underlying mechanism is largely unknown, and no obvious mutations in the claudin 1 gene (CLDN1)
Smail Hadj-Rabia et al.
Gastroenterology, 127(5), 1386-1390 (2004-11-03)
Most human and animal cholestatic disorders are associated with changes in hepatocyte cytoskeleton and tight junctions (TJs). These changes are usually secondary and nonspecific phenomena, both in intra- and extrahepatic cholestasis. Recently, missense mutations in TJ protein 2 (ZO-2) have
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.