콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV32759

Sigma-Aldrich

Anti-HMG20A (AB2) antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-FLJ10739, Anti-HMGX1, Anti-High-mobility group 20A

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩618,643

₩618,643


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩618,643

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩618,643


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

40 kDa

종 반응성

mouse, rat, dog, guinea pig, horse, human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... HMG20A(10363)

일반 설명

HMG20A is a homeobox gene that is expressed ubiquitously[1]. Studies in CHO-K1 cells have reported that it interacts with the poxvirus protein, CP77, and modulates its dissociation from the genome of vaccinia virus[2].
Rabbit Anti-HMG20A (AB2) antibody recognizes bovine, human, mouse, rat, and canine HMG20A.

면역원

Synthetic peptide directed towards the middle region of human HMG20A

애플리케이션

Rabbit Anti-HMG20A (AB2) antibody can be used for western blot applications at 1.25 μg/ml.

생화학적/생리학적 작용

HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4

서열

Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Jye-Chian Hsiao et al.
Journal of virology, 80(15), 7714-7728 (2006-07-15)
Vaccinia virus does not grow in Chinese hamster ovary (CHO-K1) cells in the absence of a viral host range factor, cowpox protein CP77. In this study, CP77 was fused to the C terminus of green fluorescence protein (GFP-CP77) and a
L Sumoy et al.
Cytogenetics and cell genetics, 88(1-2), 62-67 (2000-04-25)
The HMG box encodes a conserved DNA binding domain found in many proteins and is involved in the regulation of transcription and chromatin conformation. We describe HMG20A and HMG20B, two novel human HMG box-containing genes, discovered within the EURO-IMAGE Consortium

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.