AV32598

Anti-GTF2H4 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-General transcription factor IIH, polypeptide 4, 52 kDa, Anti-TFIIH
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 52 kDa
• 종 반응성: human, mouse, guinea pig, dog, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_001508
• UniProt 수납 번호: Q92759
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GTF2H4(2968)

설명

일반 설명

GTF2H4 is a 52kDa transcription factor. Mutations in this gene have been linked to the risk of multiple sclerosis.
Rabbit Anti-GTF2H4 antibody recognizes human, mouse, rat, bovine, and pig GTF2H4.

면역원

Synthetic peptide directed towards the N terminal region of human GTF2H4

애플리케이션

Rabbit Anti-GTF2H4 antibody can be used for western blot applications at a concentration of 1μg/ml.

생화학적/생리학적 작용

GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.

서열

Synthetic peptide located within the following region: ESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable