₩863,867
예상 입고일2025년 5월 22일세부사항
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
47 kDa
종 반응성
guinea pig, dog, rabbit, human, rat, sheep, mouse
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... POU2F3(25833)
일반 설명
POU2F3, also known as Skn-1a and OCT11, gene is mapped to human chromosome 11q23.3. The gene codes for a keratinocyte-specific POU transcription factor. The protein is expressed in stratified squamous epithelia, including the epidermis, cervix and foreskin.
면역원
Synthetic peptide directed towards the N terminal region of human POU2F3
애플리케이션
Rabbit Anti-POU2F3 antibody can be used for western blotting applications at a concentration of 0.5μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.
생화학적/생리학적 작용
POU2F3 is a transcription factor that is involved in the growth and differentiation of keratinocytes. Studies have reported that Pou2f3 (Skn-1a) is involved in the differentiation of chemosensory cells. Furthermore, this transcription factor is also required for specifying the lineage of taste receptor cells.
서열
Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Makoto Ohmoto et al.
Bioscience, biotechnology, and biochemistry, 77(10), 2154-2156 (2013-10-08)
Solitary chemosensory cells in the non-neuronal epithelium of the anterior nasal cavity have bitter taste cell-like molecular characteristics and are involved in the detection of noxious substances. Here, we demonstrate that Pou2f3/Skn-1a, which is necessary for generation of sweet, umami
Monika I Hollenhorst et al.
Respiratory research, 24(1), 267-267 (2023-11-05)
Airway tuft cells, formerly called brush cells have long been described only morphologically in human airways. More recent RNAseq studies described a chemosensory cell population, which includes tuft cells, by a distinct gene transcription signature. Yet, until which level in
Ichiro Matsumoto et al.
Nature neuroscience, 14(6), 685-687 (2011-05-17)
Functional diversification of taste cells is crucial for proper discrimination of taste qualities. We found the homeodomain protein Skn-1a (Pou2f3) to be expressed in sweet, umami and bitter taste cells. Skn-1a-deficient mice lacked electrophysiological and behavioral responses to sweet, umami
Z Zhang et al.
Oncogene, 25(39), 5436-5445 (2006-04-12)
POU2F3 (OCT11, Skn-1a) is a keratinocyte-specific POU transcription factor whose expression is tied to squamous epithelial stratification. It is also a candidate tumor suppressor gene in cervical cancer (CC) because it lies in a critical loss of heterozygosity region on
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
