추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
35 kDa
종 반응성
human, rat, pig, dog
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TFEC(22797)
일반 설명
TFEC is a basic helix-loop-helix protein that forms heterodimers with TFE3 and subsequently blocks transcriptional stimulation. TFEC may be involved in the regulation of macrophage-specific genes.
Rabbit Anti-TFEC antibody recognizes mouse, canine, bovine, rat, and human TFEC.
Rabbit Anti-TFEC antibody recognizes mouse, canine, bovine, rat, and human TFEC.
면역원
Synthetic peptide directed towards the N terminal region of human TFEC
애플리케이션
Rabbit Anti-TFEC antibody can be used for western blot applications at a concentration of 0.25μg/ml.
생화학적/생리학적 작용
TFEC is an activator of transcription with two separate activation domains.
서열
Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Nur P Damayanti et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 24(23), 5977-5989 (2018-08-01)
Translocation renal cell carcinoma (tRCC) represents a rare subtype of kidney cancer associated with various TFE3, TFEB, or MITF gene fusions that are not responsive to standard treatments for RCC. Therefore, the identification of new therapeutic targets represents an unmet
M Rehli et al.
Journal of immunology (Baltimore, Md. : 1950), 162(3), 1559-1565 (1999-02-11)
The murine homologue of the TFEC was cloned as part of an analysis of the expression of the microphthalmia-TFE (MiT) subfamily of transcription factors in macrophages. TFEC, which most likely acts as a transcriptional repressor in heterodimers with other MiT
G Q Zhao et al.
Molecular and cellular biology, 13(8), 4505-4512 (1993-08-01)
We have identified a new basic helix-loop-helix (BHLH) DNA-binding protein, designated TFEC, which is closely related to TFE3 and TFEB. The basic domain of TFEC is identical to the basic DNA-binding domain of TFE3 and TFEB, whereas the helix-loop-helix motif
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.