추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
68 kDa
종 반응성
rabbit, dog, horse, human, mouse, pig, rat
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PCSK6(5046)
일반 설명
PCSK6 is a proprotein convertase that processes inactive protein into their active forms. PCSK6 has been linked to handedness in dyslexic individuals and has also been implicated in malignant gliomas.
Rabbit Anti-PCSK6 antibody recognizes human, mouse, rat, and canine PCSK6.
Rabbit Anti-PCSK6 antibody recognizes human, mouse, rat, and canine PCSK6.
면역원
Synthetic peptide directed towards the N terminal region of human PCSK6
애플리케이션
Rabbit Anti-PCSK6 antibody can be used for western blot applications at a concentration of 2.5μg/ml.
생화학적/생리학적 작용
PCSK6 is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. This gene is thought to play a role in tumor progression.
서열
Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Thomas S Scerri et al.
Human molecular genetics, 20(3), 608-614 (2010-11-06)
Approximately 90% of humans are right-handed. Handedness is a heritable trait, yet the genetic basis is not well understood. Here we report a genome-wide association study for a quantitative measure of relative hand skill in individuals with dyslexia [reading disability
S Delic et al.
Neuropathology and applied neurobiology, 38(2), 201-212 (2011-07-05)
The molecular mechanisms underlying the infiltrative growth of glioblastomas, the most common primary tumours of the central nervous system in adults, are still poorly understood. We aimed to identify and functionally validate novel glioma invasion-associated candidate genes. Microarray-based expression analysis
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
