ZBTB32 is a zinc-finger protein that can repress the expression of CIITA and MHC II genes during B cell differentiation. Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.
면역원
Synthetic peptide directed towards the N terminal region of human ZBTB32
애플리케이션
Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
생화학적/생리학적 작용
ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.
서열
Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of immunology (Baltimore, Md. : 1950), 189(5), 2393-2403 (2012-08-02)
CIITA and MHC class II expression is silenced during the differentiation of B cells to plasma cells. When B cell differentiation is carried out ex vivo, CIITA silencing occurs rapidly, but the factors contributing to this event are not known.
질문
후기
★★★★★ 평점 값 없음
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..