콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV31652

Sigma-Aldrich

Anti-ESR2 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-Estrogen receptor 2 (ER β)

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩564,340

₩564,340


예상 입고일2025년 5월 21일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요


크기 선택

보기 변경
100 μL
₩564,340

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩564,340


예상 입고일2025년 5월 21일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

59 kDa

종 반응성

mouse, human, pig, bovine, rat

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ESR2(2100)

일반 설명

ESR2 is a nuclear transcription factor that belongs to the estrogen receptor family. ESR2 polymorphisms have been linked to anorexia nervosa, blood pressure, breast cancer and endometrial tumors.
Rabbit Anti-ESR2 antibody recognizes canine, human, mouse, rat, pig, and bovine ESR2.

면역원

Synthetic peptide directed towards the N terminal region of human ESR2

애플리케이션

Rabbit Anti-ESR2 antibody can be used for western blot applications at a dilution of 1μg/ml.

생화학적/생리학적 작용

ESR2 is a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.

서열

Synthetic peptide located within the following region: TPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Paula Maguire et al.
Breast cancer research and treatment, 94(2), 145-152 (2005-11-02)
Estrogen is involved in both normal mammary development and in breast carcinogenesis. A family history of disease and exposure to estrogen are major risk factors for developing breast cancer. Estrogen exerts its biological effects through binding to the estrogen receptors
H Eastwood et al.
Molecular psychiatry, 7(1), 86-89 (2002-01-23)
There is significant evidence for genetic factors in the susceptibility to anorexia nervosa (AN). Previously genetic variation in the estrogen receptor 2 gene (ESR2) has been studied, however no strong evidence of association with AN has been found. In the
S Ogawa et al.
Journal of human genetics, 45(6), 327-330 (2001-02-24)
We investigated the association between a dinucleotide (cytosine-adenine; CA) repeat polymorphism located in the flanking region of the human estrogen receptor beta (ESR2) gene and systemic blood pressure in 187 healthy postmenopausal Japanese women. The genotype was classified as "A"
Veronica Wendy Setiawan et al.
Cancer causes & control : CCC, 15(6), 627-633 (2004-07-29)
We hypothesized that variations in the ESR2 gene may influence estrogen exposure in the uterus and thus influence endometrial cancer risk. We validated and screened for variants in the ESR2 gene and examined whether they are associated with endometrial cancer

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.