추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
53 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TCFL5(10732)
일반 설명
TCFL5 is a basic helix-loop-helix (bHLH) protein that is expressed in primary spermatocytes. Studies in mice have revealed that Tcfl5 associated with the Calmegin gene promoter during spermatogenesis.
Rabbit Anti-TCFL5 antibody recognizes mouse and human TCFL5.
Rabbit Anti-TCFL5 antibody recognizes mouse and human TCFL5.
면역원
Synthetic peptide directed towards the middle region of human TCFL5
애플리케이션
Rabbit Anti-TCFL5 antibody can be used for western blot assays at a concentration of 2.0μg/ml. The antibody product can also be used for IHC applications (4-8μg/ml, using paraffin-embedded tissues).
생화학적/생리학적 작용
TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.
서열
Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
O Maruyama et al.
Cytogenetics and cell genetics, 82(1-2), 41-45 (1998-10-09)
We have isolated a novel human gene that is expressed specifically in primary spermatocytes in the testis. The cDNA contains an open reading frame of 1356 bp, encoding a 452-amino-acid protein that includes a basic Helix-Loop-Helix (bHLH) motif. The gene
Michel Siep et al.
Nucleic acids research, 32(21), 6425-6436 (2004-12-09)
In mouse spermatogenesis, differentiating germ line cells initiate expression of specific genes at subsequent developmental steps. The Calmegin (Clgn) gene is first expressed in meiotic prophase, in primary spermatocytes, and encodes a protein that acts as a chaperone. To identify
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.