APREST92191

PrEST Antigen LDOC1

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• 동의어(들): BCUR1, Mar7, Mart7
• UNSPSC 코드: 12352202

속성

• 재조합: expressed in E. coli
• 분석: >80% (SDS-PAGE)
• 양식: buffered aqueous solution
• 분자량: predicted mol wt 23 kDa
• 정제법: immobilized metal affinity chromatography (IMAC)
• 농도: ≥0.5 mg/mL
• 면역원 서열: ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD
• Ensembl | 인체 수납 번호: ENSG00000182195
• UniProt 수납 번호: O95751
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... LDOC1(23641)

설명

일반 설명

Recombinant protein fragment of Human LDOC1 with N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

애플리케이션

Blocking agent and positive assay control using corresponding antibodies.

결합

Corresponding Antibody HPA061842.

물리적 형태

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

제조 메모

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

법적 정보

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable