MAB2290

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

clone 29A3, Chemicon^®, from mouse

• 동의어(들): CD49c
• UNSPSC 코드: 12352203
• eCl@ss: 32160702
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 항체 형태: purified antibody
• 항체 생산 유형: primary antibodies
• 클론: 29A3, monoclonal
• 종 반응성: human
• 제조업체/상표: Chemicon^®
• 기술: immunocytochemistry: suitable; immunohistochemistry: suitable; western blot: suitable
• 동형: IgG1
• NCBI 수납 번호: NM_002204.1; NM_005501.1
• UniProt 수납 번호: P26006
• 배송 상태: wet ice
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ITGA3(3675)

설명

일반 설명

MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.

특이성

Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

SPECIES REACTIVITIES:

Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.

면역원

Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY

애플리케이션

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.

Western Blot

Immunocytochemistry

Immunohistochemistry (Frozen Sections)

Optimal working dilutions must be determined by the end user.

물리적 형태

Format: Purified

Purified. Liquid in PBS containing 0.01% sodium azide.

기타 정보

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

법적 정보

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable